PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.C01100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family GRAS
Protein Properties Length: 494aa    MW: 54817.2 Da    PI: 4.6279
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.C01100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4324.5e-1321244923373
              GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                       +lL++cA  +++g++++a+++++ l++++s +g+p  R+aay++eALaar+ +s+ +lykal+++e +   ss++l+a+++++ev+P+++f++
  Migut.C01100.1.p 124 SLLFACAASIQNGNFAEASHMINVLRQRVSIQGEPSGRIAAYMVEALAARVESSGRGLYKALKCKEPP---SSDRLSAMQVLFEVCPCFRFGF 213
                       79*****************************************************************9...9********************* PP

              GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                       ++aN aIlea + e+rvHiiDfdi+qG Q+ +Llq+La+ ++  p++R+Tgv++pes+      l  +g+rL+++A+ l+vpfef++ v++++
  Migut.C01100.1.p 214 MAANGAILEACKDENRVHIIDFDINQGSQYYTLLQTLAKTSGRRPHVRLTGVDDPESVqrGVGGLTVIGQRLEQLAKDLRVPFEFHA-VTSET 305
                       ********************************************************99878889***********************.7999* PP

              GRAS 187 edleleeLrvkp.gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpre 278
                       + +++++L+++p +Eal+Vn+++qlh+++desvs+ + rd++L++vk+l+Pk+v+vveq++++n+++Fl rf ea +yysa+f+sl+a+l+r+
  Migut.C01100.1.p 306 ALVSPSTLDCQPgEEALVVNFAFQLHHMPDESVSTVNLRDRLLRMVKGLNPKLVTVVEQDVNTNTAPFLIRFGEAYDYYSAVFESLDATLGRD 398
                       ************999****************************************************************************** PP

              GRAS 279 seerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvS 371
                       s++r++vE+++l+r+i nvvaceg+er+er e ++kWr+r+++aGF++ p++ ++  +++ l+++++++ y+v+ee+g l +gW+d+ L+++S
  Migut.C01100.1.p 399 SQDRVNVEKQCLARDIINVVACEGEERIERYEVAGKWRARMSMAGFSSSPIGRNVSGEIRKLIKEYSDR-YTVKEENGGLHFGWEDKMLIVCS 490
                       *******************************************************************66.*********************** PP

              GRAS 372 aW 373
                       aW
  Migut.C01100.1.p 491 AW 492
                       ** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.17696474IPR005202Transcription factor GRAS
PfamPF035141.6E-129124492IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 494 aa     Download sequence    Send to blast
MSLVRPAAFF GNHELYSIKN GDNTSVAQST STSNSDNTES YSSENYGNDP YQPNYESDMI  60
DYDDAQMKLK LQELEHALLD NDDDSDNNYN NGMETENETE DSPKEYSSSG SIFSSTSVAT  120
SPKSLLFACA ASIQNGNFAE ASHMINVLRQ RVSIQGEPSG RIAAYMVEAL AARVESSGRG  180
LYKALKCKEP PSSDRLSAMQ VLFEVCPCFR FGFMAANGAI LEACKDENRV HIIDFDINQG  240
SQYYTLLQTL AKTSGRRPHV RLTGVDDPES VQRGVGGLTV IGQRLEQLAK DLRVPFEFHA  300
VTSETALVSP STLDCQPGEE ALVVNFAFQL HHMPDESVST VNLRDRLLRM VKGLNPKLVT  360
VVEQDVNTNT APFLIRFGEA YDYYSAVFES LDATLGRDSQ DRVNVEKQCL ARDIINVVAC  420
EGEERIERYE VAGKWRARMS MAGFSSSPIG RNVSGEIRKL IKEYSDRYTV KEENGGLHFG  480
WEDKMLIVCS AWM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-531264928374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012843245.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_012843246.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLA0A022QX640.0A0A022QX64_ERYGU; Uncharacterized protein
STRINGSolyc04g064550.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA89672429
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1